PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G186800.1.p
Common NameSETIT_030262mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 364aa    MW: 38053.5 Da    PI: 6.7285
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G186800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.25.7e-38651651101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkC+++C+lap+fpa+q+++f n+h+lFG+s+++k+l+++++e+  da+++l+++++ara dPv G+v +i +l++q++q++
  Seita.2G186800.1.p  65 ACAACKYQRRKCNPNCPLAPHFPADQQRRFLNAHRLFGVSKIQKTLRRIDPERSADAIKTLIFQSDARAADPVGGCVTIIENLRRQIDQTE 155
                         7****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                          ela++++++
  Seita.2G186800.1.p 156 LELAYVRQQI 165
                         ******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.64164165IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-3665162IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MSTSSSSPKP PPPQHLRLHV DTATAATTTN GSAASPGSAS SSHSSRSPRP SASAAAAAGP  60
GQNQACAACK YQRRKCNPNC PLAPHFPADQ QRRFLNAHRL FGVSKIQKTL RRIDPERSAD  120
AIKTLIFQSD ARAADPVGGC VTIIENLRRQ IDQTELELAY VRQQIAIYRR AAAAGGADPA  180
MILPAAASAA TAVAGQDNAG VAVGALYAGQ GPVPAGAGVI FQDQQGYHVL KVDDQNGHPP  240
PQQLYNYFCY GMAGDEATSP DGSVQQQYGF ADAAGVKMGS PAGLGEQLEQ QCRLEAVPFV  300
DAFDVKPQAM PATIEHHGPA GVVRREDKLA AAVLKHDVDQ HMEEPAETAA GAPCELELGF  360
SSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703062e-44HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK3ZUI10.0K3ZUI1_SETIT; Uncharacterized protein
STRINGSi030262m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-29LOB domain-containing protein 22